제품 > 항체 > 다중클론항체(pAb)

CX3CR1 Rabbit pAb (A2890)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CX3CR1 Rabbit pAb (A2890) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - CX3CR1 Rabbit pAb (A2890)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using CX3CR1 Rabbit pAb (A2890) at dilution of 1:20 (40x lens). Microwave antigen retrieval performed with 0.05M Tris/EDTA Buffer (pH 8.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using CX3CR1 Rabbit pAb (A2890) at dilution of 1:20 (40x lens). Microwave antigen retrieval performed with 0.05M Tris/EDTA Buffer (pH 8.0) prior to IHC staining.

Overview

Product name	CX3CR1 Rabbit pAb
Catalog No.	A2890
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CX3CR1 (NP_001328.1).
Sequence	AMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGF
Gene ID
Swiss Prot
Synonyms	V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1; CX3CR1
Calculated MW	40kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Raji, SH-SY5Y, Mouse spinal cord, Mouse brain, Rat testis
Cellular location	Cell membrane, Multi-pass membrane protein.
Customer validation	WB(Rattus norvegicus) IF(Mus musculus) WB(Mus musculus)