제품 > 항체 > 단일클론항체(mAb)

CXCL4/PF4 Rabbit mAb (A3694)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CXCL4/PF4 Rabbit mAb (A3694) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - CXCL4/PF4 Rabbit mAb (A3694)

Immunohistochemistry analysis of paraffin-embedded Rat lung using CXCL4/PF4 Rabbit mAb (A3694) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse bone marrow using CXCL4/PF4 Rabbit mAb (A3694) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - CXCL4/PF4 Rabbit mAb (A3694)

Confocal imaging of Mouse leg bone using CXCL4/PF4 Rabbit mAb (A3694, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Overview

Product name	CXCL4/PF4 Rabbit mAb
Catalog No.	A3694
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2076

Background

This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. The protein also exhibits antimicrobial activity against Plasmodium falciparum.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-101 of human CXCL4/CXCL4/PF4 (P02776).
Sequence	MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Gene ID
Swiss Prot
Synonyms	PF-4; CXCL4; SCYB4; CXCL4/PF4
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:100 - 1:1000 IF/ICC 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Human plasma, Mouse spleen
Cellular location	cytoplasm, extracellular region, extracellular space.
Customer validation	IHC(Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증세포 고유의 선천 면역 신호전달 경로케모카인

CXCL4/PF4 Rabbit mAb images

Western blot - CXCL4/PF4 Rabbit mAb (A3694)

Immunohistochemistry - CXCL4/PF4 Rabbit mAb (A3694)

Immunofluorescence - CXCL4/PF4 Rabbit mAb (A3694)

Confocal imaging of Mouse leg bone using CXCL4/PF4 Rabbit mAb (A3694, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

* For research use only. Not for therapeutic or diagnostic purposes.