제품 > 항체 > 단일클론항체(mAb)

Calmodulin 1/2/3 Rabbit mAb (A4885)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Calmodulin 1/2/3 Rabbit mAb (A4885) at 1:1000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Calmodulin 1/2/3 Rabbit mAb (A4885)

Confocal imaging of paraffin-embedded Rat brain using Calmodulin 1/2/3 Rabbit mAb (A4885, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded Mouse brain using Calmodulin 1/2/3 Rabbit mAb (A4885, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	Calmodulin 1/2/3 Rabbit mAb
Catalog No.	A4885
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0316

Background

This gene encodes a member of the EF-hand calcium-binding protein family. It is one of three genes which encode an identical calcium binding protein which is one of the four subunits of phosphorylase kinase. Two pseudogenes have been identified on chromosome 7 and X. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1).
Sequence	LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Gene ID
Swiss Prot
Synonyms	CALML2; CAMI; CPVT4; DD132; LQT14; PHKD; caM; Calmodulin 1/2/3
Calculated MW	16kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HT-29, MCF7, U-87MG, Mouse liver
Cellular location	Cytoplasm, cytoskeleton, spindle, spindle pole.
Customer validation	WB(Homo sapiens, Mus musculus, Rattus norvegicus)