제품 > 항체 > 단일클론항체(mAb)

Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148)

Immunohistochemistry analysis of Carbonic Anhydrase 2 (CA2) in paraffin-embedded human colon tissue using Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of Carbonic Anhydrase 2 (CA2) in paraffin-embedded mouse brain tissue using Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of Carbonic Anhydrase 2 (CA2) in paraffin-embedded mouse kidney tissue using Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of Carbonic Anhydrase 2 (CA2) in paraffin-embedded rat brain tissue using Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of Carbonic Anhydrase 2 (CA2) in paraffin-embedded rat colon tissue using Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of Carbonic Anhydrase 2 (CA2) in paraffin-embedded rat kidney tissue using Carbonic Anhydrase 2 (CA2) Rabbit mAb (A9148) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Review

Overview

Product name	Carbonic Anhydrase 2 (CA2) Rabbit mAb
Catalog No.	A9148
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1451

Background

The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 161-260 of human Carbonic Anhydrase 2 (CA2) (P00918).
Sequence	DVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Gene ID
Swiss Prot
Synonyms	CAC; CAII; Car2; CA-II; HEL-76; HEL-S-282
Calculated MW	29kDa
Observed MW	29kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, Mouse spinal cord, Mouse brain, Mouse kidney, Rat spinal cord, Rat brain
Cellular location	Cell membrane, Cytoplasm
Customer validation	(293T、Hela、SKOV-3, 293T Hela SKOV-3)