제품 > 항체 > 다중클론항체(pAb)

Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb (A16225)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb (A16225) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb (A16225)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb (A16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb (A16225) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	Casein Kinase 1 alpha (CSNK1A1) Rabbit pAb
Catalog No.	A16225
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables protein serine/threonine kinase activity. Involved in several processes, including negative regulation of canonical Wnt signaling pathway; peptidyl-serine phosphorylation; and positive regulation of proteasomal ubiquitin-dependent protein catabolic process. Located in centrosome; cytosol; and nuclear speck. Part of beta-catenin destruction complex. Colocalizes with keratin filament and mRNA cleavage and polyadenylation specificity factor complex. Biomarker of Alzheimer's disease and inclusion body myositis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 238-337 of human Casein Kinase 1 alpha (CSNK1A1) (NP_001883.4).
Sequence	EKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Gene ID
Swiss Prot
Synonyms	CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p; Casein Kinase 1 alpha (CSNK1A1)
Calculated MW	39kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	U-87MG, HeLa, MCF7, PC-3, Mouse brain
Cellular location	Chromosome, Cytoplasm, Nucleus speckle, centromere, centrosome, cytoskeleton, kinetochore, microtubule organizing center
Customer validation	WB(Homo sapiens)