제품 > 항체 > 다중클론항체(pAb)

Caspase-4 Rabbit pAb (A19305)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from SW620 cells, using Caspase-4 Rabbit pAb (A19305) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

Western blot analysis of lysates from THP-1 cells, using Caspase-4 Rabbit pAb (A19305) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Caspase-4 Rabbit pAb (A19305)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Caspase-4 Rabbit pAb (A19305) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human breast cancer using Caspase-4 Rabbit pAb (A19305) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	Caspase-4 Rabbit pAb
Catalog No.	A19305
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 81-270 of human Caspase-4 (NP_001216.1).
Sequence	QISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRD
Gene ID
Swiss Prot
Synonyms	TX; Mih1; ICH-2; Mih1/TX; ICEREL-II; ICE(rel)II; Caspase-4
Calculated MW	43kDa
Observed MW	43kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SW620, THP-1
Cellular location	AIM2 inflammasome complex, cytoplasm, cytosol, endoplasmic reticulum, extracellular region, IPAF inflammasome complex, mitochondrion, NLRP3 inflammasome complex, plasma membrane
Customer validation	WB(Mus musculus, Homo sapiens, Rattus norvegicus) IHC(Homo sapiens, Mus musculus)