제품 > 항체 > 다중클론항체(pAb)

Clathrin heavy chain Rabbit pAb (A7886)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Clathrin heavy chain antibody (A7886) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Clathrin heavy chain Rabbit pAb
Catalog No.	A7886
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1550-1650 of human Clathrin heavy chain (NP_004850.1)
Sequence	AEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVP
Gene ID
Swiss Prot
Synonyms	Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2
Calculated MW	192kDa
Observed MW	180kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, BT-474, Mouse brain, Mouse lung, Rat brain
Cellular location	Cytoplasmic side, Cytoplasmic vesicle membrane, Melanosome, Membrane, Peripheral membrane protein, coated pit