제품 > 항체 > 다중클론항체(pAb)

Clathrin heavy chain Rabbit pAb (A12423)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Clathrin heavy chain Rabbit pAb (A12423) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - Clathrin heavy chain Rabbit pAb (A12423)

Immunofluorescence analysis of HeLa cells using Clathrin heavy chain Rabbit pAb (A12423) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Clathrin heavy chain Rabbit pAb
Catalog No.	A12423
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1451-1675 of human Clathrin heavy chain (NP_004850.1).
Sequence	YLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
Gene ID
Swiss Prot
Synonyms	Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2; Clathrin heavy chain
Calculated MW	192kDa
Observed MW	191kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, HepG2, NIH/3T3, Mouse brain, Mouse lung, Rat brain
Cellular location	Cytoplasmic side, Cytoplasmic vesicle membrane, Melanosome, Membrane, Peripheral membrane protein, coated pit
Customer validation	WB(Homo sapiens, Sus scrofa, Bombyx mori Linnaeus) IF(Homo sapiens, Sus scrofa) IP(Sus scrofa)