제품 > 항체 > 단일클론항체(mAb)

Clathrin heavy chain Rabbit mAb (A4943)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Clathrin heavy chain Rabbit mAb (A4943) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Clathrin heavy chain Rabbit mAb (A4943)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Clathrin heavy chain Rabbit mAb (A4943) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Clathrin heavy chain Rabbit mAb (A4943) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Clathrin heavy chain Rabbit mAb (A4943) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Clathrin heavy chain Rabbit mAb (A4943)

Confocal imaging of HeLa cells using Clathrin heavy chain Rabbit mAb (A4943, dilution 1:100) (Red). The cells were counterstained with α-Tubulin Rabbit mAb (AC049, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

ABclonal:Immunoprecipitation - Clathrin heavy chain Rabbit mAb (A4943)

Immunoprecipitation analysis of 300 μg extracts of NIH/3T3 cells using 3 μg Clathrin heavy chain antibody (A4943). Western blot was performed from the immunoprecipitate using Clathrin heavy chain antibody (A4943) at a dilution of 1:1000.

Overview

Product name	Clathrin heavy chain Rabbit mAb
Catalog No.	A4943
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1228

Background

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin heavy chain (Q00610).
Sequence	SFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
Gene ID
Swiss Prot
Synonyms	Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2; Clathrin heavy chain
Calculated MW	191kDa
Observed MW	192kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:2000 IF/ICC 1:100 - 1:400 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	NIH/3T3, Jurkat, C6, Mouse kidney, Rat kidney
Cellular location	Cytoplasmic side, Cytoplasmic vesicle membrane, Melanosome, Membrane, Peripheral membrane protein, coated pit.
Customer validation	IF(Homo sapiens, Mus musculus)