Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Clathrin heavy chain Rabbit mAb |
---|---|
Catalog No. | A4943 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1228 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin heavy chain (Q00610). |
---|---|
Sequence | SFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG |
Gene ID | |
Swiss Prot | |
Synonyms | Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2; Clathrin heavy chain |
Calculated MW | 191kDa |
Observed MW | 192kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | NIH/3T3, Jurkat, C6, Mouse kidney, Rat kidney |
Cellular location | Cytoplasmic side, Cytoplasmic vesicle membrane, Melanosome, Membrane, Peripheral membrane protein, coated pit. |
Customer validation | IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4943? Please let us know so that we can cite the reference in this datasheet.