제품 > 항체 > 단일클론항체(mAb)

PBEF/Visfatin/NAMPT Rabbit mAb (A22044)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from U-87MG cells, using PBEF/Visfatin/NAMPT Rabbit mAb (A22044) at1:110000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Western blot analysis of various lysates using PBEF/Visfatin/NAMPT Rabbit mAb (A22044) at1:110000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PBEF/Visfatin/NAMPT Rabbit mAb (A22044)

Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using PBEF/Visfatin/NAMPT Rabbit mAb (A22044) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using PBEF/Visfatin/NAMPT Rabbit mAb (A22044) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using PBEF/Visfatin/NAMPT Rabbit mAb (A22044) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using PBEF/Visfatin/NAMPT Rabbit mAb (A22044) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using PBEF/Visfatin/NAMPT Rabbit mAb (A22044) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	PBEF/Visfatin/NAMPT Rabbit mAb
Catalog No.	A22044
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53731

Background

This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on chromosome 10.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PBEF/Visfatin/NAMPT (NP_005737.1).
Sequence	VSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGSGGGLLQKLTRDLLNCSFK
Gene ID
Swiss Prot
Synonyms	VF; PBEF; PBEF1; VISFATIN; 1110035O14Rik; PBEF/Visfatin/NAMPT
Calculated MW	56kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:55000 - 1:220000 IHC-P 1:2000 - 1:20000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	U-87MG, NIH/3T3, PC-12
Cellular location	Cytoplasm, Nucleus, Secreted.
Customer validation	WB(Mus musculus, Homo sapiens) IHC(Mus musculus)