제품 > 항체 > 단일클론항체(mAb)

Cytokeratin 15 (KRT15) Rabbit mAb (A4854)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of extracts of CAL 27 cells, using Cytokeratin 15 (KRT15) (KRT15) antibody (A4854) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - Cytokeratin 15 (KRT15) Rabbit mAb (A4854)

Immunofluorescence analysis of rat skin using Cytokeratin 15 (KRT15) (KRT15) Rabbit mAb (A4854) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Cytokeratin 15 (KRT15) Rabbit mAb
Catalog No.	A4854
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0270

Background

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 357-456 of human Cytokeratin 15 (KRT15) (KRT15) (P19012).
Sequence	YATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIAIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Gene ID
Swiss Prot
Synonyms	K15; CK15; K1CO
Calculated MW	49kDa
Observed MW	49kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	CAL 27
Cellular location	Cytoskeleton, cytosol, extracellular exosome, nucleus
Customer validation	IF(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 15 (KRT15) Rabbit mAb images

Western blot - Cytokeratin 15 (KRT15) Rabbit mAb (A4854)

Immunofluorescence - Cytokeratin 15 (KRT15) Rabbit mAb (A4854)

Immunofluorescence analysis of rat skin using Cytokeratin 15 (KRT15) (KRT15) Rabbit mAb (A4854) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.