Review (1)Publications (7) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Cytokeratin 19 (KRT19) Rabbit pAb (A0247) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human colon using Cytokeratin 19 (KRT19) Rabbit pAb (A0247) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta using Cytokeratin 19 (KRT19) Rabbit pAb (A0247) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using Cytokeratin 19 (KRT19) Rabbit pAb (A0247) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of MCF7 cells using Cytokeratin 19 (KRT19) Rabbit pAb (A0247) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Cytokeratin 19 (KRT19) Rabbit pAb |
|---|---|
| Catalog No. | A0247 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 210-340 of human Cytokeratin 19 (KRT19) (NP_002267.2). |
|---|---|
| Sequence | ELAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | K19; CK19; K1CS; Cytokeratin 19 (KRT19) |
| Calculated MW | 44kDa |
| Observed MW | 40kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse lung, Rat lung |
| Cellular location | apicolateral plasma membrane, costamere, cytoskeleton, cytosol, extracellular exosome, plasma membrane, sarcolemma, terminal web, Z disc. |
| Customer validation | (HepG2) IF(Homo sapiens) IHC(Mus musculus) FC(Mus musculus) IF(Mus musculus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0247? Please let us know so that we can cite the reference in this datasheet.
i_FC_01.jpg?t=1704935971)
i_FC_01.jpg?t=1704935967)
i_FC_01.jpg?t=1704936115)
