제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A24259)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and MCF7 cells (right) were intracellularly-stained with ABflo® 594 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb(A24259, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 MCF7 were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb(A24259, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb
Catalog No.	A24259
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54260-ABflo594

Background

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (NP_002267.2).
Sequence	RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Gene ID
Swiss Prot
Synonyms	K19; CK19; K1CS
Calculated MW	44kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Apicolateral plasma membrane, costamere, Cytoskeleton, cytosol, Extracellular exosome, Plasma membrane, Sarcolemma, terminal web, Z disc