제품 > 항체 > 단일클론항체(mAb)

Cytokeratin 19 (KRT19) Rabbit mAb (A25546)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of paraffin-embedded Human hepatocholangiocarcinoma and hepatocellular carcinoma tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human hepatocholangiocarcinoma tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Cytokeratin 19 (KRT19) Rabbit mAb (A25546) at a dilution of 1:10000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Flow CytoMetry - Cytokeratin 19 (KRT19) Rabbit mAb (A25546)

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and MCF7 cells (right) were intracellularly-stained with Cytokeratin 19 (KRT19) Rabbit mAb (A25546, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 MCF7 cells were intracellularly-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or Cytokeratin 19 (KRT19) Rabbit mAb (A25546, 2 μg/mL, right), followed by FITC conjugated goat anti-Rabbit pAb staining.

Overview

Product name	Cytokeratin 19 (KRT19) Rabbit mAb
Catalog No.	A25546
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54260

Background

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (KRT19) (NP_002267.2).
Sequence	RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Gene ID
Swiss Prot
Synonyms	K19; CK19; K1CS
Calculated MW	44kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:5000 - 1:20000 IF/ICC 1:200 - 1:800 FC (intra) 1:1000 - 1:5000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Cytoplasm, apicolateral plasma membrane, costamere, cytoskeleton, cytosol, extracellular exosome, plasma membrane, sarcolemma, terminal web, Z disc.