제품 > 항체 > 단일클론항체(mAb)

CoREST/RCOR1 Rabbit mAb (A3568)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CoREST/RCOR1 Rabbit mAb (A3568) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of lysates from C2C12 cells, using CoREST/RCOR1 Rabbit mAb (A3568) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - CoREST/RCOR1 Rabbit mAb (A3568)

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using CoREST/RCOR1 Rabbit mAb (A3568) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using CoREST/RCOR1 Rabbit mAb (A3568) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using CoREST/RCOR1 Rabbit mAb (A3568) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - CoREST/RCOR1 Rabbit mAb (A3568)

Immunoprecipitation analysis of 300 μg extracts of THP-1 cells using 3 μg CoREST/RCOR1 antibody (A3568). Western blot was performed from the immunoprecipitate using CoREST/RCOR1 antibody (A3568) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - CoREST/RCOR1 Rabbit mAb (A3568)

Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using CoREST/RCOR1 antibody (A3568) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	CoREST/RCOR1 Rabbit mAb
Catalog No.	A3568
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2044

Background

This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CoREST/RCOR1 (Q9UKL0).
Sequence	MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEH
Gene ID
Swiss Prot
Synonyms	RCOR; COREST; CoREST/RCOR1
Calculated MW	53kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:200 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HT-29, HepG2, C2C12
Cellular location	Nucleus.
Customer validation	IP(homo sapiens)