제품 > 항체 > 다중클론항체(pAb)

CoREST/RCOR1 Rabbit pAb (A12845)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using CoREST/RCOR1 Rabbit pAb (A12845) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - CoREST/RCOR1 Rabbit pAb (A12845)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg CoREST/RCOR1 antibody (A12845). Western blot was performed from the immunoprecipitate using CoREST/RCOR1 antibody (A12845) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - CoREST/RCOR1 Rabbit pAb (A12845)

Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using CoREST/RCOR1 antibody (A12845) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	CoREST/RCOR1 Rabbit pAb
Catalog No.	A12845
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 256-485 of human CoREST/CoREST/RCOR1 (NP_055971.2).
Sequence	EREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS
Gene ID
Swiss Prot
Synonyms	RCOR; COREST; CoREST/RCOR1
Calculated MW	53kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, Jurkat, Mouse testis, Mouse brain
Cellular location	Nucleus.