Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | Collagen X/COL10A1 Rabbit pAb |
---|---|
Catalog No. | A18604 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 521-680 of human Collagen X/COL10A1 (NP_000484.2). |
---|---|
Sequence | MPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM |
Gene ID | |
Swiss Prot | |
Synonyms | COL10A1; collagen alpha-1(X) chain; Collagen X/COL10A1 |
Calculated MW | 66kDa |
Observed MW | 66kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Rat lung |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | WB(Gallus gallus, Mus musculus, Homo sapiens) IHC(Rattus norvegicus, Homo sapiens) IHC(Mus musculus, Gallus gallus) IF(Gallus gallus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18604? Please let us know so that we can cite the reference in this datasheet.