Reviews (2)Publications (7) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Product name | Collagen X/COL10A1 Rabbit pAb |
---|---|
Catalog No. | A6889 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 521-680 of human Collagen X/Collagen X/COL10A1 (NP_000484.2). |
---|---|
Sequence | MPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM |
Gene ID | |
Swiss Prot | |
Synonyms | COL10A1; Collagen X/COL10A1 |
Calculated MW | 66kDa |
Observed MW | Refer to figures |
Reactivity | Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | |
Cellular location | Secreted, extracellular matrix, extracellular space |
Customer validation | (Mouse paw, Mouse cartilage) IF(Mus musculus) IHC(Mus musculus, Homo sapiens) IF(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A6889? Please let us know so that we can cite the reference in this datasheet.