제품 > 항체 > 단일클론항체(mAb)

Cullin 4A Rabbit mAb (A5064)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using Cullin 4A Rabbit mAb (A5064) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - Cullin 4A Rabbit mAb (A5064)

Immunohistochemistry analysis of paraffin-embedded Human colon using Cullin 4A Rabbit mAb (A5064) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	Cullin 4A Rabbit mAb
Catalog No.	A5064
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1237

Background

CUL4A is the ubiquitin ligase component of a multimeric complex involved in the degradation of DNA damage-response proteins (Liu et al., 2009 [PubMed 19481525]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 660-759 of human Cullin 4A (Q13619).
Sequence	FKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
Gene ID
Swiss Prot
Synonyms	CUL4A; cullin-4A; Cullin 4A
Calculated MW	88kDa
Observed MW	88kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Raji
Cellular location	Nucleoplasm, Nucleus
Customer validation	WB(Homo sapiens, Oryza sativa)