제품 > 항체 > 다중클론항체(pAb)

Cytokeratin 15 (KRT15) Rabbit pAb (A2660)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using Cytokeratin 15 (KRT15) Rabbit pAb (A2660) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - Cytokeratin 15 (KRT15) Rabbit pAb (A2660)

Immunofluorescence analysis of A431 cells using Cytokeratin 15 (KRT15) Rabbit pAb (A2660) at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Cytokeratin 15 (KRT15) Rabbit pAb
Catalog No.	A2660
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cytokeratin 15 (KRT15) (P19012).
Sequence	LLSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELA
Gene ID
Swiss Prot
Synonyms	K15; CK15; K1CO; Cytokeratin 15 (KRT15)
Calculated MW	49kDa
Observed MW	47-50kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	TE-1, HeLa, SW480, OVCAR-3
Cellular location	cytoskeleton, cytosol, extracellular exosome, nucleus.
Customer validation	IHC(Homo sapiens) IF(Ovis aries, Mus musculus)