제품 > 항체 > 단일클론항체(mAb)

Cytokeratin 20 (CK20) Rabbit mAb (A19041)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from HT-29 cells, using Cytokeratin 20 (CK20) Rabbit mAb (A19041) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from Rat liver, using Cytokeratin 20 (CK20) Rabbit mAb (A19041) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - Cytokeratin 20 (CK20) Rabbit mAb (A19041)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Cytokeratin 20 (CK20) Rabbit mAb (A19041) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human appendix tissue using Cytokeratin 20 (CK20) Rabbit mAb (A19041) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Cytokeratin 20 (CK20) Rabbit mAb (A19041) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human stomach tissue using Cytokeratin 20 (CK20) Rabbit mAb (A19041) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	Cytokeratin 20 (CK20) Rabbit mAb
Catalog No.	A19041
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0288

Background

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 325-424 of human Cytokeratin 20 (KRT20) (P35900).
Sequence	LANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI
Gene ID
Swiss Prot
Synonyms	K20; CD20; KRT20; CK-20; KRT21; Cytokeratin 20 (CK20)
Calculated MW	48kDa
Observed MW	44kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HT-29 cells, Rat liver
Cellular location	Cytoplasm.
Customer validation	Other(Homo sapiens)