Cytokeratin 20 (KRT20) Rabbit pAb (A0248)

Reviews (2) Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

ABclonal:Immunofluorescence - Cytokeratin 20 (KRT20) Rabbit pAb (A0248)

Confocal immunofluorescence analysis of A-431 cells using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (A0248) at dilution of 1:200. Blue: DAPI for nuclear staining.

Review

Overview

Product name	Cytokeratin 20 (KRT20) Rabbit pAb
Catalog No.	A0248
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 245-424 of human Cytokeratin 20 (Cytokeratin 20 (KRT20)) (NP_061883.1).
Sequence	KYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI
Gene ID
Swiss Prot
Synonyms	K20; CD20; CK20; CK-20; KRT21
Calculated MW	48kDa
Observed MW	43kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Mouse intestine
Cellular location	Cytoplasm
Customer validation	(Mouse colon) IF(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 20 (KRT20) Rabbit pAb images

Immunofluorescence - Cytokeratin 20 (KRT20) Rabbit pAb (A0248)

Confocal immunofluorescence analysis of A-431 cells using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (A0248) at dilution of 1:200. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.