Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Cytokeratin 7 (KRT7) (KRT7) Rabbit mAb (A4765) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates using Cytokeratin 7 (KRT7) (KRT7) Rabbit mAb (A4765) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 7 (KRT7) Rabbit mAb (A4765) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
| Product name | Cytokeratin 7 (KRT7) Rabbit mAb |
|---|---|
| Catalog No. | A4765 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1267 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 7 (KRT7) (P08729). |
|---|---|
| Sequence | MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | K7; CK7; SCL; K2C7; Cytokeratin 7 (KRT7) |
| Calculated MW | 51kDa |
| Observed MW | 52kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, A-549, Mouse lung, Mouse kidney, Rat kidney |
| Cellular location | Cytoplasm. |
| Customer validation | IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4765? Please let us know so that we can cite the reference in this datasheet.
