제품 > 항체 > 다중클론항체(pAb)

Cytokeratin 7 (KRT7) Rabbit pAb (A2574)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of HeLa cells, using Cytokeratin 7 (Cytokeratin 7 (KRT7)) antibody (A2574).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - Cytokeratin 7 (KRT7) Rabbit pAb (A2574)

Immunofluorescence analysis of human lung cancer cells using Cytokeratin 7 (Cytokeratin 7 (KRT7)) antibody (A2574) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse bronchus cells using Cytokeratin 7 (Cytokeratin 7 (KRT7)) antibody (A2574) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of rat bronchus cells using Cytokeratin 7 (Cytokeratin 7 (KRT7)) antibody (A2574) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	Cytokeratin 7 (KRT7) Rabbit pAb
Catalog No.	A2574
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 230-469 of human Cytokeratin 7 (Cytokeratin 7 (KRT7)) (NP_005547.3).
Sequence	ETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Gene ID
Swiss Prot
Synonyms	K7; CK7; SCL; K2C7
Calculated MW	51kDa
Observed MW	51kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa
Cellular location	Cytoplasm
Customer validation	WB(Mus musculus, Homo sapiens) IHC(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 7 (KRT7) Rabbit pAb images

Western blot - Cytokeratin 7 (KRT7) Rabbit pAb (A2574)

Immunofluorescence - Cytokeratin 7 (KRT7) Rabbit pAb (A2574)

Immunofluorescence analysis of human lung cancer cells using Cytokeratin 7 (Cytokeratin 7 (KRT7)) antibody (A2574) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence - Cytokeratin 7 (KRT7) Rabbit pAb (A2574)

Immunofluorescence analysis of mouse bronchus cells using Cytokeratin 7 (Cytokeratin 7 (KRT7)) antibody (A2574) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence - Cytokeratin 7 (KRT7) Rabbit pAb (A2574)

Immunofluorescence analysis of rat bronchus cells using Cytokeratin 7 (Cytokeratin 7 (KRT7)) antibody (A2574) at dilution of 1:100. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.