제품 > 항체 > 단일클론항체(mAb)

DDIT3/CHOP Rabbit mAb (A21902)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells using DDIT3/CHOP Rabbit mAb (A21902) at 1:1000 dilution incubated overnight at 4℃. HeLa cells were treated by tunicamycin (2 μg/ml) for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Western blot analysis of lysates from C6 cells using DDIT3/CHOP Rabbit mAb (A21902) at 1:900 dilution incubated overnight at 4℃. C6 cells were treated by tunicamycin (2 μg/ml) for 8 hours
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of lysates from C2C12 cells using DDIT3/CHOP Rabbit mAb (A21902) at 1:900 dilution incubated overnight at 4℃. C2C12 cells were treated by tunicamycin (2 μg/ml) for 8 hours
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - DDIT3/CHOP Rabbit mAb (A21902)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using DDIT3/CHOP Rabbit mAb (A21902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using DDIT3/CHOP Rabbit mAb (A21902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - DDIT3/CHOP Rabbit mAb (A21902)

Immunofluorescence analysis of C2C12 cells (treated with Tunicamycan) and C2C12 cells (untreated) using DDIT3/CHOP Rabbit mAb (A21902) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	DDIT3/CHOP Rabbit mAb
Catalog No.	A21902
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51417

Background

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDIT3/CHOP (NP_004074.2).
Sequence	MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQG
Gene ID
Swiss Prot
Synonyms	CHOP; CEBPZ; CHOP10; CHOP-10; GADD153; AltDDIT3; C/EBPzeta; DDIT3/CHOP
Calculated MW	19kDa
Observed MW	27/27kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:100 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	C6 treated by tunicamycin, C2C12 treated by tunicamycin, HeLa treated by tunicamycin
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Gallus gallus, Homo sapiens)