Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | DDX21 Rabbit pAb |
---|---|
Catalog No. | A7034 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 624-783 of human DDX21 (NP_004719.2). |
---|---|
Sequence | VDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ |
Gene ID | |
Swiss Prot | |
Synonyms | RH; GUA; GURDB; II/Gu; RH II/Gu; RH-II/GU; gu-alpha; RH-II/GuA; DDX21 |
Calculated MW | 87kDa |
Observed MW | 100kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SW620, MCF7, HepG2, 293T, Mouse spleen, Mouse thymus |
Cellular location | Nucleus, nucleolus, nucleoplasm. |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus) IF(Homo sapiens) WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7034? Please let us know so that we can cite the reference in this datasheet.