제품 > 항체 > 다중클론항체(pAb)

DNMT3A Rabbit pAb (A3169)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using DNMT3A Rabbit pAb (A3169).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of various lysates using DNMT3A Rabbit pAb (A3169) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - DNMT3A Rabbit pAb (A3169)

Immunofluorescence analysis of A549 cells using DNMT3A Rabbit pAb (A3169).Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Overview

Product name	DNMT3A Rabbit pAb
Catalog No.	A3169
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-700 of human DNMT3A (NP_072046.2).
Sequence	LNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGP
Gene ID
Swiss Prot
Synonyms	TBRS; HESJAS; DNMT3A2; M.HsaIIIA; DNMT3A
Calculated MW	102kDa
Observed MW	95kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:20 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse spleen, Mouse skeletal muscle
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Mus musculus, Homo sapiens, Mus musculus) IF(Mus musculus) IF(Mus musculus) IHC(Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달핵심 히스톤의 후성유전적 writer & eraserDNA 메틸화

DNMT3A Rabbit pAb images

Western blot - DNMT3A Rabbit pAb (A3169)

Immunofluorescence - DNMT3A Rabbit pAb (A3169)

Immunofluorescence analysis of A549 cells using DNMT3A Rabbit pAb (A3169).Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.