제품 > 항체 > 단일클론항체(mAb)

[KO Validated] DNMT3A Rabbit mAb (A19659)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Mouse Thymus using DNMT3A Rabbit mAb (A19659) at 1:500 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type (WT) and DNMT3A knockout (KO) 293T cells using [KO Validated] DNMT3A (A19659) at 1:500 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - [KO Validated] DNMT3A Rabbit mAb (A19659)

Immunoprecipitation of DNMT3A from 300 µg extracts of 293T cells was performed using 3 µg of DNMT3A antibody (A19659). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNMT3A antibody (A19659) at a dilution of 1:1000.

Overview

Product name	[KO Validated] DNMT3A Rabbit mAb
Catalog No.	A19659
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0138

Background

CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 550-650 of human DNMT3A (Q9Y6K1).
Sequence	GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVL
Gene ID
Swiss Prot
Synonyms	TBRS; HESJAS; DNMT3A2; M.HsaIIIA; 3A
Calculated MW	102kDa
Observed MW	85kDa/95kDa/130kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	293T
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Homo sapiens, Mus musculus) ChIP(Homo sapiens)