Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | [KO Validated] DNMT3A Rabbit mAb |
---|---|
Catalog No. | A19659 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0138 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human DNMT3A (Q9Y6K1). |
---|---|
Sequence | GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVL |
Gene ID | |
Swiss Prot | |
Synonyms | TBRS; HESJAS; DNMT3A2; M.HsaIIIA; 3A |
Calculated MW | 102kDa |
Observed MW | 130kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Homo sapiens, Mus musculus) ChIP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19659? Please let us know so that we can cite the reference in this datasheet.