Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Monkey
The STORM super-resolution (SR) imaging of COS7 cells using DRP1 Rabbit mAb (A21968, ABclonal) at dilution of 1:100 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Ningbo Nano-Micro imaging Biotechnology Co., Ltd. in SR image processing and kindly providing this image.
Western blot analysis of various lysates using DRP1 Rabbit mAb (A21968) at 1:6000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of lysates from PC-12 cells using DRP1 Rabbit mAb (A21968) at 1:6000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Confocal imaging of HeLa cells using DRP1 Rabbit mAb (A21968, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of paraffin-embedded Mouse brain tissue using DRP1 Rabbit mAb (A21968, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
| Product name | DRP1 Rabbit mAb |
|---|---|
| Catalog No. | A21968 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC54410 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 561-670 of human DRP1 (NP_036192.2). |
|---|---|
| Sequence | QDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DLP1; DRP1; DVLP; EMPF; OPA5; EMPF1; DYMPLE; HDYNIV |
| Calculated MW | 82kDa |
| Observed MW | 78kDa/82kDa |
| Reactivity | Human, Mouse, Rat, Monkey |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | U-2 OS, C2C12, PC-12 |
| Cellular location | Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Golgi apparatus, Membrane, Mitochondrion outer membrane, Peripheral membrane protein, Peroxisome, clathrin-coated pit, cytosol, secretory vesicle, synaptic vesicle membrane. |
| Customer validation | WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21968? Please let us know so that we can cite the reference in this datasheet.
