Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | DYNLL1 Rabbit pAb |
---|---|
Catalog No. | A14496 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1). |
---|---|
Sequence | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
Gene ID | |
Swiss Prot | |
Synonyms | LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1; DYNLL1 |
Calculated MW | 10kDa |
Observed MW | 11kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, A-549, 293T, Rat brain |
Cellular location | Cytoplasm, Mitochondrion, Nucleus, cytoskeleton |
Customer validation | WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14496? Please let us know so that we can cite the reference in this datasheet.