제품 > 항체 > 단일클론항체(mAb)

DcR1/CD263 Rabbit mAb (A24912)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from BeWo cells using DcR1/CD263 Rabbit mAb (A24912) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - DcR1/CD263 Rabbit mAb (A24912)

Immunohistochemistry analysis of DcR1/CD263 in paraffin-embedded human spleen tissue using DcR1/CD263 Rabbit mAb (A24912) at a dilution of 1:200(40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Flow CytoMetry - DcR1/CD263 Rabbit mAb (A24912)

Flow cytometry: 1X10^6 K-562 cells (Low Expression, left) and BEWO cells (right) were surface-stained with DcR1/CD263 Rabbit mAb (A24912, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 BEWO cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or DcR1/CD263 Rabbit mAb (A24912, 2 μg/mL, right).

Overview

Product name	DcR1/CD263 Rabbit mAb
Catalog No.	A24912
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63904

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-235 of human DcR1/CD263 (NP_003832.3).
Sequence	ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP
Gene ID
Swiss Prot
Synonyms	TNFRSF10C; CD263; DCR1; DCR1-TNFR; LIT; TRAIL-R3; TRAILR3; TRID; TNF receptor superfamily member 10c; DcR1/CD263
Calculated MW	27kDa
Observed MW	62kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 FC 1:100-1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Flow Cytometry
Positive samples	BeWo
Cellular location	Cell membrane, GPI-anchor, Lipid-anchor

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DcR1/CD263 Rabbit mAb images

Western blot - DcR1/CD263 Rabbit mAb (A24912)

Immunohistochemistry - DcR1/CD263 Rabbit mAb (A24912)

Flow CytoMetry - DcR1/CD263 Rabbit mAb (A24912)

Flow cytometry: 1X10^6 BEWO cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or DcR1/CD263 Rabbit mAb (A24912, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.