제품 > 항체 > 단일클론항체(mAb)

Dot1L/KMT4 Rabbit mAb (A12329)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Dot1L/KMT4 Rabbit mAb (A12329) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - Dot1L/KMT4 Rabbit mAb (A12329)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg Dot1L/KMT4 Rabbit mAb (A12329). Western blot was performed from the immunoprecipitate using Dot1L/KMT4 Rabbit mAb (A12329) at a dilution of 1:1000.

Overview

Product name	Dot1L/KMT4 Rabbit mAb
Catalog No.	A12329
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0688

Background

The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dot1L/KMT4 (NP_115871.1).
Sequence	MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNT
Gene ID
Swiss Prot
Synonyms	DOT1; KMT4; Dot1L/KMT4
Calculated MW	165kDa
Observed MW	170kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, U-87MG, Mouse brain
Cellular location	Nucleus.
Customer validation	WB(Mus musculus)