제품 > 항체 > 다중클론항체(pAb)

Dot1L/KMT4 Rabbit pAb (A11285)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat, Mouse

Western blot analysis of lysates from Rat liver, using Dot1L/KMT4 Rabbit pAb (A11285) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Overview

Product name	Dot1L/KMT4 Rabbit pAb
Catalog No.	A11285
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Dot1L/KMT4 (NP_115871.1).
Sequence	MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVD
Gene ID
Swiss Prot
Synonyms	DOT1; KMT4; Dot1L/KMT4
Calculated MW	165kDa
Observed MW	185kDa

Applications

Reactivity	Rat, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat liver
Cellular location	Nucleus
Customer validation	WB(Gallus gallus, Mus musculus, Rattus norvegicus)