Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of lysates from human plasma, using Human IgG3 Rabbit mAb (A19713) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
| Product name | Human IgG3 Rabbit mAb |
|---|---|
| Catalog No. | A19713 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2243 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IgG3 (P01860). |
|---|---|
| Sequence | VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSC |
| Gene ID | |
| Swiss Prot | |
| Synonyms | IgG3; Human IgG3 |
| Calculated MW | 41kDa |
| Observed MW | 60kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | human plasma |
| Cellular location | Blood microparticle, External side of plasma membrane, Extracellular exosome, Extracellular region, Extracellular space, Immunoglobulin complex, Circulating |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
