제품 > 항체 > 단일클론항체(mAb)

EGF Rabbit mAb (A26211)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of Recombinant Mouse EGF Protein (RP01684) using EGF Rabbit mAb (A26211) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 5ng/1ng/0.1ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	EGF Rabbit mAb
Catalog No.	A26211
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68560

Background

This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 977-1029 of mouse EGF (NP_034243.2).
Sequence	NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Gene ID
Swiss Prot
Synonyms	EGF
Calculated MW	133kDa
Observed MW	11kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Recombinant Mouse EGF Protein
Cellular location	Membrane.