Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using EIF4A1/EIF4A2/EIF4A3 Rabbit mAb (A24293) at 1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human kidney using EIF4A1/EIF4A2/EIF4A3 Rabbit mAb (A24293) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using EIF4A1/EIF4A2/EIF4A3 Rabbit mAb (A24293) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat lung using EIF4A1/EIF4A2/EIF4A3 Rabbit mAb (A24293) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of C6 cells using EIF4A1/EIF4A2/EIF4A3 Rabbit mAb (A24293) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of MCF7 cells using EIF4A1/EIF4A2/EIF4A3 Rabbit mAb (A24293) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using EIF4A1/EIF4A2/EIF4A3 Rabbit mAb (A24293) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | EIF4A1/EIF4A2/EIF4A3 Rabbit mAb |
|---|---|
| Catalog No. | A24293 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC56701 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EIF4A1/EIF4A2/EIF4A3 (NP_001407.1/NP_001958.2/NP_055555.1). |
|---|---|
| Sequence | MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DDX2A; EIF4A; EIF-4A; eIF4A-I; eIF-4A-I; DDX2B; EIF4F; BM-010; eIF4A-II; eIF-4A-II; Fal1; RCPS; DDX48; MUK34; NUK34; NMP265; eIF4AIII; eIF4A-III; eIF-4A-III; EIF4A1/EIF4A2/EIF4A3 |
| Calculated MW | 46kDa |
| Observed MW | 46kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | MCF7, HeLa, C2C12, PC-12, Rat brain |
| Cellular location | Cytoplasm, Cytosol, Eukaryotic translation initiation factor 4F complex, Extracellular exosome. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
