Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using ENTPD5 Rabbit mAb (A19647) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates using ENTPD5 Rabbit mAb (A19647) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of ENTPD5 in paraffin-embedded rat kidney tissue using ENTPD5 Rabbit mAb (A19647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of ENTPD5 in paraffin-embedded rat liver tissue using ENTPD5 Rabbit mAb (A19647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of ENTPD5 in paraffin-embedded mouse kidney tissue using ENTPD5 Rabbit mAb (A19647) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | ENTPD5 Rabbit mAb |
|---|---|
| Catalog No. | A19647 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2211 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human ENTPD5 (O75356). |
|---|---|
| Sequence | GAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PCPH; CD39L4; NTPDase-5; ENTPD5 |
| Calculated MW | 48kDa |
| Observed MW | 48kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | 293T, PC-3, Mouse liver, Rat liver, Rat kidney |
| Cellular location | endoplasmic reticulum, extracellular region, extracellular space |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
