ENTPD5 Rabbit pAb (A8108)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - ENTPD5 Rabbit pAb (A8108)

Immunofluorescence analysis of U2OS cells using ENTPD5 antibody (A8108) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	ENTPD5 Rabbit pAb
Catalog No.	A8108
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 149-428 of human ENTPD5 (NP_001240.1).
Sequence	KEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH
Gene ID
Swiss Prot
Synonyms	PCPH; CD39L4; NTPDase-5
Calculated MW	48kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Endoplasmic reticulum, Secreted