제품 > 항체 > 단일클론항체(mAb)

EXOSC7 Rabbit mAb (A0341)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using EXOSC7 Rabbit mAb (A0341) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - EXOSC7 Rabbit mAb (A0341)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using EXOSC7 Rabbit mAb (A0341) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	EXOSC7 Rabbit mAb
Catalog No.	A0341
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2501

Background

Predicted to enable 3'-5'-exoribonuclease activity and RNA binding activity. Predicted to be involved in RNA metabolic process. Part of exosome (RNase complex).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 192-291 of human EXOSC7 (Q15024).
Sequence	LSVENVPCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVLHASLQSVVHKEESLGPKRQKVGFLG
Gene ID
Swiss Prot
Synonyms	p8; EAP1; RRP42; Rrp42p; hRrp42p; EXOSC7
Calculated MW	32kDa
Observed MW	37kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, A-431, K-562, U-251MG
Cellular location	Cytoplasm, Nucleus, nucleolus