Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FAK Rabbit mAb |
---|---|
Catalog No. | A11131 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0171 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FAK (Q05397). |
---|---|
Sequence | TVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIG |
Gene ID | |
Swiss Prot | |
Synonyms | FAK; FADK; FAK1; FRNK; FADK 1; PPP1R71; p125FAK; pp125FAK |
Calculated MW | 119kDa |
Observed MW | 125kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | MCF7, Mouse brain, Rat brain |
Cellular location | Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Nucleus, Peripheral membrane protein, cell cortex, centrosome, cytoskeleton, focal adhesion, microtubule organizing center |
Customer validation | WB(Homo sapiens, Mus musculus) IF(Homo sapiens, Rattus norvegicus) IHC(Homo sapiens) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11131? Please let us know so that we can cite the reference in this datasheet.