제품 > 항체 > 단일클론항체(mAb)

FAM38A/PIEZO1 Rabbit mAb (A23380)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from MCF7 cells using FAM38A/PIEZO1 Rabbit mAb (A23380) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Western blot analysis of lysates from Mouse lung using FAM38A/PIEZO1 Rabbit mAb (A23380) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.

ABclonal:Immunohistochemistry - FAM38A/PIEZO1 Rabbit mAb (A23380)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using FAM38A/PIEZO1 Rabbit mAb (A23380) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using FAM38A/PIEZO1 Rabbit mAb (A23380) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using FAM38A/PIEZO1 Rabbit mAb (A23380) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Overview

Product name	FAM38A/PIEZO1 Rabbit mAb
Catalog No.	A23380
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60118

Background

The protein encoded by this gene is a mechanically-activated ion channel that links mechanical forces to biological signals. The encoded protein contains 36 transmembrane domains and functions as a homotetramer. Defects in this gene have been associated with dehydrated hereditary stomatocytosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 2199-2429 of human PIEZO1(NP_001136336.2).
Sequence	VVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSP
Gene ID
Swiss Prot
Synonyms	ER; DHS; Mib; LMPH3; FAM38A; LMPHM6; FAM38A/PIEZO1
Calculated MW	287kDa
Observed MW	287kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	MCF7, Mouse lung
Cellular location	Cell membrane, Cell projection, Endoplasmic reticulum membrane, Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, lamellipodium membrane.
Customer validation	IHC(Mus musculus) IF(Mus musculus) WB(Mus musculus)