Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FGF2 Rabbit mAb |
---|---|
Catalog No. | A22330 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51110 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5). |
---|---|
Sequence | RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE |
Gene ID | |
Swiss Prot | |
Synonyms | BFGF; FGFB; FGF-2; HBGF-2 |
Calculated MW | 17kDa/21kDa/22kDa/30kDa |
Observed MW | 18kDa/22kDa/26kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SKOV3, Mouse lung, Mouse ovary, Mouse spleen, Rat ovary, Rat spleen |
Cellular location | Nucleus, Secreted |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.