제품 > 항체 > 단일클론항체(mAb)

FGF7/KGF Rabbit mAb (A5966)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using FGF7/FGF7/KGF Rabbit mAb (A5966) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	FGF7/KGF Rabbit mAb
Catalog No.	A5966
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2107

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF7/FGF7/KGF (NP_002000.1).
Sequence	MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEI
Gene ID
Swiss Prot
Synonyms	KGF; HBGF-7; Fibroblast growth factor 7
Calculated MW	12kDa/23kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, A549, Raji, Mouse lung, Mouse spleen, Mouse uterus, Rat lung, Rat spleen, Rat uterus
Cellular location	Cytoplasm, Extracellular region, Extracellular space, Golgi apparatus
Customer validation	IF(Homo sapiens)