Reviews (2)Publications (5) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | FOXO3A Rabbit mAb |
---|---|
Catalog No. | A9270 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1505 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 574-673 of human FOXO3A (NP_001446.1). |
---|---|
Sequence | SPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG |
Gene ID | |
Swiss Prot | |
Synonyms | FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2 |
Calculated MW | 71kDa |
Observed MW | 90kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, PC-3, Mouse lung, Mouse brain |
Cellular location | Cytoplasm, Nucleus, cytosol. |
Customer validation | (293T 、PC-3 、HepG2 、ES-2, 293T PC-3 T47D ES-2) WB(Mus musculus, Homo sapiens) RT-qPCR(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A9270? Please let us know so that we can cite the reference in this datasheet.