제품 > 항체 > 단일클론항체(mAb)

FOXO3A Rabbit mAb (A9270)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using FOXO3A Rabbit mAb (A9270) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Review

Overview

Product name	FOXO3A Rabbit mAb
Catalog No.	A9270
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1505

Background

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 574-673 of human FOXO3A (NP_001446.1).
Sequence	SPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
Gene ID
Swiss Prot
Synonyms	FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2
Calculated MW	71kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, PC-3, Mouse lung, Mouse brain
Cellular location	Cytoplasm, Nucleus, cytosol.
Customer validation	(293T 、PC-3 、HepG2 、ES-2, 293T PC-3 T47D ES-2) WB(Mus musculus, Homo sapiens)