제품 > 항체 > 다중클론항체(pAb)

FSTL4 Rabbit pAb (A18233)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using FSTL4 Rabbit pAb (A18233) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 2s.

ABclonal:Immunofluorescence - FSTL4 Rabbit pAb (A18233)

Immunofluorescence analysis of L929 cells using FSTL4 Rabbit pAb (A18233) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	FSTL4 Rabbit pAb
Catalog No.	A18233
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable brain-derived neurotrophic factor binding activity and calcium ion binding activity. Predicted to be involved in cell differentiation. Predicted to act upstream of or within negative regulation of brain-derived neurotrophic factor receptor signaling pathway; negative regulation of collateral sprouting; and negative regulation of dendritic spine development. Predicted to be located in extracellular region and secretory granule.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-250 of human FSTL4 (NP_055897.1).
Sequence	GWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACLLGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYMAFQVVQLSLA
Gene ID
Swiss Prot
Synonyms	FSTL4
Calculated MW	93kDa
Observed MW	85kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-87MG, U-251MG, SH-SY5Y, NCI-H460, A-549, Mouse heart, Mouse brain, Rat heart, Rat brain
Cellular location	extracellular region