Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Fbx32/FBXO32 Rabbit pAb |
---|---|
Catalog No. | A3193 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 206-355 of human Fbx32/FBOX32 (NP_478136.1). |
---|---|
Sequence | WQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF |
Gene ID | |
Swiss Prot | |
Synonyms | Fbx32; MAFbx; Fbx32/FBXO32 |
Calculated MW | 42kDa |
Observed MW | 40kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse skeletal muscle |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Sus scrofa, Mus musculus, Rattus norvegicus, Homo sapiens) PCR(Mus musculus) qPCR(Mus musculus) RT-qPCR(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3193? Please let us know so that we can cite the reference in this datasheet.