제품 > 항체 > 단일클론항체(mAb)

Fibrinogen alpha chain (FGA) Rabbit mAb (A19658)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Fibrinogen alpha chain (FGA) (FGA) Rabbit mAb (A19658) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Fibrinogen alpha chain (FGA) Rabbit mAb (A19658)

Immunohistochemistry analysis of paraffin-embedded Mouse lung using Fibrinogen alpha chain (FGA) (FGA) Rabbit mAb (A19658) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat lung using Fibrinogen alpha chain (FGA) (FGA) Rabbit mAb (A19658) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta using Fibrinogen alpha chain (FGA) (FGA) Rabbit mAb (A19658) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	Fibrinogen alpha chain (FGA) Rabbit mAb
Catalog No.	A19658
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2227

Background

This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinogen alpha chain (FGA) (FGA) (P02671).
Sequence	NDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCA
Gene ID
Swiss Prot
Synonyms	Fib2; Fibrinogen alpha chain (FGA)
Calculated MW	95kDa
Observed MW	95kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Rat liver
Cellular location	blood microparticle, cell surface, endoplasmic reticulum, endoplasmic reticulum lumen, external side of plasma membrane, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, fibrinogen complex, plasma membrane.
Customer validation	IHC(Mus musculus) WB(Mus musculus)