제품 > 항체 > 단일클론항체(mAb)

Flt3/CD135 Rabbit mAb (A24344)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of paraffin-embedded Human kidney using Flt3/CD135 Rabbit mAb (A24344) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon using Flt3/CD135 Rabbit mAb (A24344) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Flow CytoMetry - Flt3/CD135 Rabbit mAb (A24344)

Flow cytometry: 1X10^6 HEL cells (negative control, Left) and REH cells(Right) were surface-stained with Flt3/CD135 Rabbit mAb(A24344, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line), followed by Alexa Fluor®647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 REH cells cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or Flt3/CD135 Rabbit mAb(A24344, 2 μg/mL, right).

Overview

Product name	Flt3/CD135 Rabbit mAb
Catalog No.	A24344
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63041

Background

This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 27-163 of human Flt3/CD135 (NP_004110.2).
Sequence	NQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNT
Gene ID
Swiss Prot
Synonyms	FLK2; STK1; CD135; FLK-2; Flt3/CD135
Calculated MW	108KDa/113kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200 FC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Flow Cytometry
Positive samples
Cellular location	Endoplasmic reticulum lumen, Membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Flt3/CD135 Rabbit mAb images

Immunohistochemistry - Flt3/CD135 Rabbit mAb (A24344)

Flow CytoMetry - Flt3/CD135 Rabbit mAb (A24344)

Flow cytometry:1X10^6 REH cells cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or Flt3/CD135 Rabbit mAb(A24344, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.