Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | G3BP1 Rabbit mAb |
---|---|
Catalog No. | A3968 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0875 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human G3BP1 (Q13283). |
---|---|
Sequence | EVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGM |
Gene ID | |
Swiss Prot | |
Synonyms | G3BP; HDH-VIII; G3BP1 |
Calculated MW | 52kDa |
Observed MW | 68kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, 293T, PC-3, Mouse testis, Rat testis |
Cellular location | Cell membrane, Cytoplasm, Cytoplasmic granule, Nucleus, cytosol. |
Customer validation | WB(Homo sapiens, Chlorocebus aethiops) IF(Homo sapiens, Mus musculus) IF(Chlorocebus aethiops) Co-IP(Mus musculus) IF(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3968? Please let us know so that we can cite the reference in this datasheet.