Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using G3BP1 Rabbit mAb (A3968) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Confocal imaging of HeLa cells using G3BP1 Rabbit mAb (A3968, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Confocal imaging of HeLa cells (treated with sodium arsenite) and HeLa cells (untreated) using G3BP1 Rabbit mAb (A3968, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of PC-12 cells (treated with sodium arsenite) and PC-12 cells (untreated) using G3BP1 Rabbit mAb (A3968, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
| Product name | G3BP1 Rabbit mAb |
|---|---|
| Catalog No. | A3968 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0875 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human G3BP1 (Q13283). |
|---|---|
| Sequence | EVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | G3BP; HDH-VIII; G3BP1 |
| Calculated MW | 52kDa |
| Observed MW | 68kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, 293T, PC-3, Mouse testis, Rat testis |
| Cellular location | Cell membrane, Cytoplasm, Cytoplasmic granule, Nucleus, cytosol. |
| Customer validation | WB(Homo sapiens, Chlorocebus aethiops) IF(Homo sapiens, Mus musculus) IF(Chlorocebus aethiops) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3968? Please let us know so that we can cite the reference in this datasheet.
