제품 > 항체 > 다중클론항체(pAb)

GABARAP Rabbit pAb (A5616)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GABARAP Rabbit pAb (A5616) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - GABARAP Rabbit pAb (A5616)

Immunohistochemistry analysis of paraffin-embedded Rat kidney using GABARAP Rabbit pAb (A5616) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using GABARAP Rabbit pAb (A5616) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - GABARAP Rabbit pAb (A5616)

Immunofluorescence analysis of MCF-7 cells using GABARAP Rabbit pAb (A5616). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	GABARAP Rabbit pAb
Catalog No.	A5616
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAP (NP_009209.1).
Sequence	MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Gene ID
Swiss Prot
Synonyms	MM46; ATG8A; GABARAP-a; GABARAP
Calculated MW	14kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	SW620, SH-SY5Y, HepG2
Cellular location	Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Golgi apparatus membrane, autophagosome, cytoskeleton

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구세포 생물학 & 발달 생물학자가포식조절자

GABARAP Rabbit pAb images

Western blot - GABARAP Rabbit pAb (A5616)

Immunohistochemistry - GABARAP Rabbit pAb (A5616)

Immunofluorescence - GABARAP Rabbit pAb (A5616)

Immunofluorescence analysis of MCF-7 cells using GABARAP Rabbit pAb (A5616). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.